Lineage for d1hxs2_ (1hxs 2:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.4: Animal virus proteins [49656] (16 proteins) 
Protein Poliovirus [49666] (3 species) 
Species Poliovirus type 1, strain Mahoney [TaxId:12080] [49667] (11 PDB entries) 
Domain d1hxs2_: 1hxs 2: [65953]
Details for d1hxs2_
PDB Entry: 1hxs (more details), 2.2 Å
PDB Description: crystal structure of mahoney strain of poliovirus at 2.2a resolution
SCOP Domain Sequences for d1hxs2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxs2_ b.10.1.4 (2:) Poliovirus {Poliovirus type 1, strain Mahoney}
acgysdrvlqltlgnstittqeaansvvaygrwpeylrdseanpvdqptepdvaacrfyt
ldtvswtkesrgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqcnaskfhqgalgvf
avpemclagdsntttmhtsyqnanpgekggtftgtftpdnnqtsparrfcpvdyllgngt
llgnafvfphqiinlrtnncatlvlpyvnslsidsmvkhnnwgiailplaplnfasessp
eipitltiapmccefnglrnitlprlq
SCOP Domain Coordinates for d1hxs2_:
Click to download the PDB-style file with coordinates for d1hxs2_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hxs2_:
- d1hxs2_ is new in SCOP 1.59
- d1hxs2_ appears in SCOP 1.61
- d1hxs2_ last appears in SCOP 1.63
View in 3D
