Lineage for d1ht2l_ (1ht2 L:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1222782Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 1222798Species Escherichia coli [TaxId:562] [56259] (8 PDB entries)
  8. 1222820Domain d1ht2l_: 1ht2 L: [65947]
    Other proteins in same PDB: d1ht2e_, d1ht2f_, d1ht2g_, d1ht2h_
    complexed with adp

Details for d1ht2l_

PDB Entry: 1ht2 (more details), 2.8 Å

PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu
PDB Compounds: (L:) heat shock locus hslv

SCOPe Domain Sequences for d1ht2l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ht2l_ d.153.1.4 (L:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

SCOPe Domain Coordinates for d1ht2l_:

Click to download the PDB-style file with coordinates for d1ht2l_.
(The format of our PDB-style files is described here.)

Timeline for d1ht2l_: