Lineage for d1ht2g_ (1ht2 G:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122576Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins)
  6. 122636Protein HslU [52721] (2 species)
  7. 122637Species Escherichia coli [TaxId:562] [52722] (8 PDB entries)
  8. 122644Domain d1ht2g_: 1ht2 G: [65942]
    Other proteins in same PDB: d1ht2a_, d1ht2b_, d1ht2c_, d1ht2d_, d1ht2i_, d1ht2j_, d1ht2k_, d1ht2l_

Details for d1ht2g_

PDB Entry: 1ht2 (more details), 2.8 Å

PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu
PDB Compounds: (G:)

SCOP Domain Sequences for d1ht2g_:

Sequence, based on SEQRES records: (download)

>d1ht2g_ c.37.1.13 (G:) HslU {Escherichia coli}
hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
dadyvskhldalvadedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1ht2g_ c.37.1.13 (G:) HslU {Escherichia coli}
hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil

SCOP Domain Coordinates for d1ht2g_:

Click to download the PDB-style file with coordinates for d1ht2g_.
(The format of our PDB-style files is described here.)

Timeline for d1ht2g_: