Lineage for d1ht2c_ (1ht2 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2548926Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 2548942Species Escherichia coli [TaxId:562] [56259] (8 PDB entries)
  8. 2548949Domain d1ht2c_: 1ht2 C: [65938]
    Other proteins in same PDB: d1ht2e1, d1ht2e2, d1ht2f1, d1ht2f2, d1ht2g1, d1ht2g2, d1ht2h1, d1ht2h2
    complexed with adp

Details for d1ht2c_

PDB Entry: 1ht2 (more details), 2.8 Å

PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu
PDB Compounds: (C:) heat shock locus hslv

SCOPe Domain Sequences for d1ht2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ht2c_ d.153.1.4 (C:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

SCOPe Domain Coordinates for d1ht2c_:

Click to download the PDB-style file with coordinates for d1ht2c_.
(The format of our PDB-style files is described here.)

Timeline for d1ht2c_: