Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily) |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein HslV (ClpQ) protease [56258] (2 species) |
Species Escherichia coli [TaxId:562] [56259] (7 PDB entries) |
Domain d1ht2a_: 1ht2 A: [65936] Other proteins in same PDB: d1ht2e_, d1ht2f_, d1ht2g_, d1ht2h_ |
PDB Entry: 1ht2 (more details), 2.8 Å
SCOP Domain Sequences for d1ht2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ht2a_ d.153.1.4 (A:) HslV (ClpQ) protease {Escherichia coli} ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
Timeline for d1ht2a_: