![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein HslV (ClpQ) protease [56258] (4 species) dodecameric prokaryotic homologue of proteasome |
![]() | Species Escherichia coli [TaxId:562] [56259] (8 PDB entries) |
![]() | Domain d1ht1x_: 1ht1 X: [65933] Other proteins in same PDB: d1ht1e_, d1ht1f_, d1ht1g_, d1ht1i_ complexed with adp |
PDB Entry: 1ht1 (more details), 2.8 Å
SCOPe Domain Sequences for d1ht1x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ht1x_ d.153.1.4 (X:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]} ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
Timeline for d1ht1x_: