Lineage for d1ht1x_ (1ht1 X:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512789Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 512790Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 512929Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 512930Protein HslV (ClpQ) protease [56258] (3 species)
    dodecameric prokaryotic homologue of proteasome
  7. 512931Species Escherichia coli [TaxId:562] [56259] (7 PDB entries)
  8. 512941Domain d1ht1x_: 1ht1 X: [65933]
    Other proteins in same PDB: d1ht1e_, d1ht1f_, d1ht1g_, d1ht1i_

Details for d1ht1x_

PDB Entry: 1ht1 (more details), 2.8 Å

PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu

SCOP Domain Sequences for d1ht1x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ht1x_ d.153.1.4 (X:) HslV (ClpQ) protease {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

SCOP Domain Coordinates for d1ht1x_:

Click to download the PDB-style file with coordinates for d1ht1x_.
(The format of our PDB-style files is described here.)

Timeline for d1ht1x_: