Lineage for d1ht1v_ (1ht1 V:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224776Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 2224792Species Escherichia coli [TaxId:562] [56259] (8 PDB entries)
  8. 2224813Domain d1ht1v_: 1ht1 V: [65932]
    Other proteins in same PDB: d1ht1e1, d1ht1e2, d1ht1f1, d1ht1f2, d1ht1g1, d1ht1g2, d1ht1i1, d1ht1i2
    complexed with adp

Details for d1ht1v_

PDB Entry: 1ht1 (more details), 2.8 Å

PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu
PDB Compounds: (V:) heat shock locus hslv

SCOPe Domain Sequences for d1ht1v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ht1v_ d.153.1.4 (V:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

SCOPe Domain Coordinates for d1ht1v_:

Click to download the PDB-style file with coordinates for d1ht1v_.
(The format of our PDB-style files is described here.)

Timeline for d1ht1v_: