Lineage for d1ht1c_ (1ht1 C:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily) Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) 
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) Protein HslV (ClpQ) protease [56258] (2 species) 
Species Escherichia coli [TaxId:562] [56259] (7 PDB entries) 
Domain d1ht1c_: 1ht1 C: [65926]
Other proteins in same PDB: d1ht1e_, d1ht1f_, d1ht1g_, d1ht1i_
Details for d1ht1c_
PDB Entry: 1ht1 (more details), 2.8 Å
PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu
SCOP Domain Sequences for d1ht1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ht1c_ d.153.1.4 (C:) HslV (ClpQ) protease {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
SCOP Domain Coordinates for d1ht1c_:
Click to download the PDB-style file with coordinates for d1ht1c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ht1c_:
- d1ht1c_ is new in SCOP 1.59
- d1ht1c_ appears in SCOP 1.61
- d1ht1c_ appears in the current release, SCOPe 2.08
View in 3D
