Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein HslV (ClpQ) protease [56258] (2 species) dodecameric prokaryotic homologue of proteasome |
Species Escherichia coli [TaxId:562] [56259] (7 PDB entries) |
Domain d1ht1b_: 1ht1 B: [65925] Other proteins in same PDB: d1ht1e_, d1ht1f_, d1ht1g_, d1ht1i_ |
PDB Entry: 1ht1 (more details), 2.8 Å
SCOP Domain Sequences for d1ht1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ht1b_ d.153.1.4 (B:) HslV (ClpQ) protease {Escherichia coli} ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
Timeline for d1ht1b_: