![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily) |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) ![]() |
![]() | Family d.109.1.2: Cofilin-like [55762] (3 proteins) |
![]() | Protein Cofilin-like domain of actin-binding protein abp1p [69793] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69794] (1 PDB entry) |
![]() | Domain d1hqz8_: 1hqz 8: [65922] |
PDB Entry: 1hqz (more details), 2.1 Å
SCOP Domain Sequences for d1hqz8_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqz8_ d.109.1.2 (8:) Cofilin-like domain of actin-binding protein abp1p {Baker's yeast (Saccharomyces cerevisiae)} pidytthsreidaeylkivrgsdpdttwliispnakkeyepestgssfhdflqlfdetkv qyglarvsppgsdvekiiiigwcpdsaplktrasfaanfaavannlfkgyhvqvtarded dldenellmkis
Timeline for d1hqz8_: