Lineage for d1hqz3_ (1hqz 3:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136694Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 136695Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 136734Family d.109.1.2: Cofilin-like [55762] (3 proteins)
  6. 136746Protein Cofilin-like domain of actin-binding protein abp1p [69793] (1 species)
  7. 136747Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69794] (1 PDB entry)
  8. 136750Domain d1hqz3_: 1hqz 3: [65917]

Details for d1hqz3_

PDB Entry: 1hqz (more details), 2.1 Å

PDB Description: cofilin homology domain of a yeast actin-binding protein abp1p

SCOP Domain Sequences for d1hqz3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqz3_ d.109.1.2 (3:) Cofilin-like domain of actin-binding protein abp1p {Baker's yeast (Saccharomyces cerevisiae)}
lepidytthsreidaeylkivrgsdpdttwliispnakkeyepestgssfhdflqlfdet
kvqyglarvsppgsdvekiiiigwcpdsaplktrasfaanfaavannlfkgyhvqvtard
eddldenellmkisn

SCOP Domain Coordinates for d1hqz3_:

Click to download the PDB-style file with coordinates for d1hqz3_.
(The format of our PDB-style files is described here.)

Timeline for d1hqz3_: