Lineage for d1hqyf_ (1hqy F:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122576Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins)
  6. 122636Protein HslU [52721] (2 species)
  7. 122637Species Escherichia coli [TaxId:562] [52722] (8 PDB entries)
  8. 122647Domain d1hqyf_: 1hqy F: [65914]
    Other proteins in same PDB: d1hqya_, d1hqyb_, d1hqyc_, d1hqyd_

Details for d1hqyf_

PDB Entry: 1hqy (more details), 2.8 Å

PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu

SCOP Domain Sequences for d1hqyf_:

Sequence, based on SEQRES records: (download)

>d1hqyf_ c.37.1.13 (F:) HslU {Escherichia coli}
hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
dadyvskhldalvadedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1hqyf_ c.37.1.13 (F:) HslU {Escherichia coli}
hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil

SCOP Domain Coordinates for d1hqyf_:

Click to download the PDB-style file with coordinates for d1hqyf_.
(The format of our PDB-style files is described here.)

Timeline for d1hqyf_: