Lineage for d1hqye_ (1hqy E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849193Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 1849332Protein HslU [52721] (2 species)
    ATPase subunit of ATP-dependent protease
  7. 1849333Species Escherichia coli [TaxId:562] [52722] (9 PDB entries)
  8. 1849344Domain d1hqye_: 1hqy E: [65913]
    Other proteins in same PDB: d1hqya_, d1hqyb_, d1hqyc_, d1hqyd_
    complexed with adp

Details for d1hqye_

PDB Entry: 1hqy (more details), 2.8 Å

PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu
PDB Compounds: (E:) heat shock locus hslu

SCOPe Domain Sequences for d1hqye_:

Sequence, based on SEQRES records: (download)

>d1hqye_ c.37.1.20 (E:) HslU {Escherichia coli [TaxId: 562]}
hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeieidlaaa
pmgveimappgmeemtsqlqsmfqnlggqkqkarklkikdamkllieeeaaklvnpeelk
qdaidaveqhgivfideidkickrgessgpdvsregvqrdllplvegctvstkhgmvktd
hilfiasgafqiakpsdlipelqgrlpirvelqalttsdferiltepnasitvqykalma
tegvnieftdsgikriaeaawqvnestenigarrlhtvlerlmeeisydasdlsgqniti
dadyvskhldalvadedlsrfil

Sequence, based on observed residues (ATOM records): (download)

>d1hqye_ c.37.1.20 (E:) HslU {Escherichia coli [TaxId: 562]}
hsemtpreivseldkhiigqdnakrsvaialrnrwrrmqlneelrhevtpknilmigptg
vgkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdaavkmvrvqaieknr
yraeelaeerildvlippaknnwgqteqqqepsaarqafrkklregqlddkeiekqkark
lkikdamkllieeeaaklvnpeelkqdaidaveqhgivfideidkickrgessgpdvsre
gvqrdllplvegctvstkhgmvktdhilfiasgafqiakpsdlipelqgrlpirvelqal
ttsdferiltepnasitvqykalmategvnieftdsgikriaeaawqvnestenigarrl
htvlerlmeeisydasdlsgqnitidadyvskhldalvadedlsrfil

SCOPe Domain Coordinates for d1hqye_:

Click to download the PDB-style file with coordinates for d1hqye_.
(The format of our PDB-style files is described here.)

Timeline for d1hqye_: