Lineage for d1hqyd_ (1hqy D:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 735799Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 735943Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 735944Protein HslV (ClpQ) protease [56258] (3 species)
    dodecameric prokaryotic homologue of proteasome
  7. 735945Species Escherichia coli [TaxId:562] [56259] (7 PDB entries)
  8. 735969Domain d1hqyd_: 1hqy D: [65912]
    Other proteins in same PDB: d1hqye_, d1hqyf_
    complexed with adp

Details for d1hqyd_

PDB Entry: 1hqy (more details), 2.8 Å

PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu
PDB Compounds: (D:) heat shock locus hslv

SCOP Domain Sequences for d1hqyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqyd_ d.153.1.4 (D:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

SCOP Domain Coordinates for d1hqyd_:

Click to download the PDB-style file with coordinates for d1hqyd_.
(The format of our PDB-style files is described here.)

Timeline for d1hqyd_: