![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily) |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) ![]() |
![]() | Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
![]() | Protein HslV (ClpQ) protease [56258] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [56259] (7 PDB entries) |
![]() | Domain d1hqyd_: 1hqy D: [65912] Other proteins in same PDB: d1hqye_, d1hqyf_ |
PDB Entry: 1hqy (more details), 2.8 Å
SCOP Domain Sequences for d1hqyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqyd_ d.153.1.4 (D:) HslV (ClpQ) protease {Escherichia coli} ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
Timeline for d1hqyd_: