Lineage for d1hqyd_ (1hqy D:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138489Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 138490Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 138590Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 138591Protein HslV (ClpQ) protease [56258] (2 species)
  7. 138592Species Escherichia coli [TaxId:562] [56259] (7 PDB entries)
  8. 138612Domain d1hqyd_: 1hqy D: [65912]
    Other proteins in same PDB: d1hqye_, d1hqyf_

Details for d1hqyd_

PDB Entry: 1hqy (more details), 2.8 Å

PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu

SCOP Domain Sequences for d1hqyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqyd_ d.153.1.4 (D:) HslV (ClpQ) protease {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

SCOP Domain Coordinates for d1hqyd_:

Click to download the PDB-style file with coordinates for d1hqyd_.
(The format of our PDB-style files is described here.)

Timeline for d1hqyd_: