Lineage for d1hqya_ (1hqy A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1934575Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 1934591Species Escherichia coli [TaxId:562] [56259] (8 PDB entries)
  8. 1934624Domain d1hqya_: 1hqy A: [65909]
    Other proteins in same PDB: d1hqye_, d1hqyf_
    complexed with adp

Details for d1hqya_

PDB Entry: 1hqy (more details), 2.8 Å

PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu
PDB Compounds: (A:) heat shock locus hslv

SCOPe Domain Sequences for d1hqya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqya_ d.153.1.4 (A:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

SCOPe Domain Coordinates for d1hqya_:

Click to download the PDB-style file with coordinates for d1hqya_.
(The format of our PDB-style files is described here.)

Timeline for d1hqya_: