Lineage for d1hqlb_ (1hql B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663440Species Griffonia simplicifolia, lectin I-b4 [TaxId:3850] [69235] (2 PDB entries)
  8. 663442Domain d1hqlb_: 1hql B: [65908]
    complexed with ca, gal, mbg, mn, nag

Details for d1hqlb_

PDB Entry: 1hql (more details), 2.2 Å

PDB Description: The xenograft antigen in complex with the B4 isolectin of Griffonia simplicifolia lectin-1
PDB Compounds: (B:) lectin

SCOP Domain Sequences for d1hqlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqlb_ b.29.1.1 (B:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]}
svsftfpnfwsdvedsiifqgdanttagtlqlcktnqygtplqwsagralysdpvqlwdn
ktesvasfyteftfflkitgngpadglafflappdsdvkdageylglfnkstatqpsknq
vvavefdtwtnpnfpepsyrhiginvnsivsvatkrwedsdifsgkiatarisydgsaei
ltvvlsypdgsdyilshsvdmrqnlpesvrvgisastgnnqfltvyilswrfssnl

SCOP Domain Coordinates for d1hqlb_:

Click to download the PDB-style file with coordinates for d1hqlb_.
(The format of our PDB-style files is described here.)

Timeline for d1hqlb_: