Lineage for d1hqla_ (1hql A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371344Species Griffonia simplicifolia, lectin I-b4 [TaxId:3850] [69235] (2 PDB entries)
  8. 371345Domain d1hqla_: 1hql A: [65907]

Details for d1hqla_

PDB Entry: 1hql (more details), 2.2 Å

PDB Description: The xenograft antigen in complex with the B4 isolectin of Griffonia simplicifolia lectin-1

SCOP Domain Sequences for d1hqla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4}
svsftfpnfwsdvedsiifqgdanttagtlqlcktnqygtplqwsagralysdpvqlwdn
ktesvasfyteftfflkitgngpadglafflappdsdvkdageylglfnkstatqpsknq
vvavefdtwtnpnfpepsyrhiginvnsivsvatkrwedsdifsgkiatarisydgsaei
ltvvlsypdgsdyilshsvdmrqnlpesvrvgisastgnnqfltvyilswrfssnl

SCOP Domain Coordinates for d1hqla_:

Click to download the PDB-style file with coordinates for d1hqla_.
(The format of our PDB-style files is described here.)

Timeline for d1hqla_: