Lineage for d1hqke_ (1hqk E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2462833Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2462834Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2462835Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2462836Protein Lumazine synthase [52123] (7 species)
  7. 2462837Species Aquifex aeolicus [TaxId:63363] [69442] (5 PDB entries)
  8. 2462857Domain d1hqke_: 1hqk E: [65906]

Details for d1hqke_

PDB Entry: 1hqk (more details), 1.6 Å

PDB Description: crystal structure analysis of lumazine synthase from aquifex aeolicus
PDB Compounds: (E:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d1hqke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqke_ c.16.1.1 (E:) Lumazine synthase {Aquifex aeolicus [TaxId: 63363]}
mqiyegkltaeglrfgivasrfnhalvdrlvegaidcivrhggreeditlvrvpgsweip
vaagelarkedidaviaigvlirgatphfdyiasevskglanlslelrkpitfgvitadt
leqaieragtkhgnkgweaalsaiemanlfkslr

SCOPe Domain Coordinates for d1hqke_:

Click to download the PDB-style file with coordinates for d1hqke_.
(The format of our PDB-style files is described here.)

Timeline for d1hqke_: