Lineage for d1hqke_ (1hqk E:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119999Fold c.16: Lumazine synthase [52120] (1 superfamily)
  4. 120000Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 120001Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 120002Protein Lumazine synthase [52123] (6 species)
  7. 120003Species Aquifex aeolicus [TaxId:63363] [69442] (1 PDB entry)
  8. 120008Domain d1hqke_: 1hqk E: [65906]

Details for d1hqke_

PDB Entry: 1hqk (more details), 1.6 Å

PDB Description: crystal structure analysis of lumazine synthase from aquifex aeolicus

SCOP Domain Sequences for d1hqke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqke_ c.16.1.1 (E:) Lumazine synthase {Aquifex aeolicus}
mqiyegkltaeglrfgivasrfnhalvdrlvegaidcivrhggreeditlvrvpgsweip
vaagelarkedidaviaigvlirgatphfdyiasevskglanlslelrkpitfgvitadt
leqaieragtkhgnkgweaalsaiemanlfkslr

SCOP Domain Coordinates for d1hqke_:

Click to download the PDB-style file with coordinates for d1hqke_.
(The format of our PDB-style files is described here.)

Timeline for d1hqke_: