Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) |
Superfamily c.16.1: Lumazine synthase [52121] (1 family) |
Family c.16.1.1: Lumazine synthase [52122] (1 protein) |
Protein Lumazine synthase [52123] (6 species) |
Species Aquifex aeolicus [TaxId:63363] [69442] (1 PDB entry) |
Domain d1hqke_: 1hqk E: [65906] |
PDB Entry: 1hqk (more details), 1.6 Å
SCOP Domain Sequences for d1hqke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqke_ c.16.1.1 (E:) Lumazine synthase {Aquifex aeolicus} mqiyegkltaeglrfgivasrfnhalvdrlvegaidcivrhggreeditlvrvpgsweip vaagelarkedidaviaigvlirgatphfdyiasevskglanlslelrkpitfgvitadt leqaieragtkhgnkgweaalsaiemanlfkslr
Timeline for d1hqke_:
View in 3D Domains from other chains: (mouse over for more information) d1hqka_, d1hqkb_, d1hqkc_, d1hqkd_ |