Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (1 family) |
Family c.16.1.1: Lumazine synthase [52122] (1 protein) |
Protein Lumazine synthase [52123] (7 species) |
Species Aquifex aeolicus [TaxId:63363] [69442] (5 PDB entries) |
Domain d1hqkc_: 1hqk C: [65904] |
PDB Entry: 1hqk (more details), 1.6 Å
SCOP Domain Sequences for d1hqkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqkc_ c.16.1.1 (C:) Lumazine synthase {Aquifex aeolicus} mqiyegkltaeglrfgivasrfnhalvdrlvegaidcivrhggreeditlvrvpgsweip vaagelarkedidaviaigvlirgatphfdyiasevskglanlslelrkpitfgvitadt leqaieragtkhgnkgweaalsaiemanlfkslr
Timeline for d1hqkc_:
View in 3D Domains from other chains: (mouse over for more information) d1hqka_, d1hqkb_, d1hqkd_, d1hqke_ |