Lineage for d1hp0a_ (1hp0 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871682Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 1871683Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 1871684Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins)
    automatically mapped to Pfam PF01156
  6. 1871685Protein Inosine-adenosine-guanosine preferring nucleoside hydrolase [69587] (1 species)
  7. 1871686Species Trypanosoma vivax [TaxId:5699] [69588] (5 PDB entries)
  8. 1871693Domain d1hp0a_: 1hp0 A: [65900]
    complexed with ad3, ca

Details for d1hp0a_

PDB Entry: 1hp0 (more details), 2.1 Å

PDB Description: crystal structure of an inosine-adenosine-guanosine-preferring nucleoside hydrolase from trypanosoma vivax in complex with the substrate analogue 3-deaza-adenosine
PDB Compounds: (A:) inosine-adenosine-guanosine-preferring nucleoside hydrolase

SCOPe Domain Sequences for d1hp0a_:

Sequence, based on SEQRES records: (download)

>d1hp0a_ c.70.1.1 (A:) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax [TaxId: 5699]}
saknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnn
mnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqql
ladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstd
gtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgt
mwamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdae
nypltfvarnpeaeffldmllrsarac

Sequence, based on observed residues (ATOM records): (download)

>d1hp0a_ c.70.1.1 (A:) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax [TaxId: 5699]}
saknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnn
mnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqql
ladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstd
gtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgt
mwamcthgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfva
rnpeaeffldmllrsarac

SCOPe Domain Coordinates for d1hp0a_:

Click to download the PDB-style file with coordinates for d1hp0a_.
(The format of our PDB-style files is described here.)

Timeline for d1hp0a_: