Lineage for d1hp0a_ (1hp0 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 126750Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
  4. 126751Superfamily c.70.1: Nucleoside hydrolase [53590] (1 family) (S)
  5. 126752Family c.70.1.1: Nucleoside hydrolase [53591] (3 proteins)
  6. 126753Protein Inosine-adenosine-guanosine preferring nucleoside hydrolase [69587] (1 species)
  7. 126754Species Trypanosoma vivax [TaxId:5699] [69588] (2 PDB entries)
  8. 126757Domain d1hp0a_: 1hp0 A: [65900]

Details for d1hp0a_

PDB Entry: 1hp0 (more details), 2.1 Å

PDB Description: crystal structure of an inosine-adenosine-guanosine-preferring nucleoside hydrolase from trypanosoma vivax in complex with the substrate analogue 3-deaza-adenosine
PDB Compounds: (A:)

SCOP Domain Sequences for d1hp0a_:

Sequence, based on SEQRES records: (download)

>d1hp0a_ c.70.1.1 (A:) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax}
saknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnn
mnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqql
ladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstd
gtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgt
mwamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdae
nypltfvarnpeaeffldmllrsarac

Sequence, based on observed residues (ATOM records): (download)

>d1hp0a_ c.70.1.1 (A:) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax}
saknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnn
mnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqql
ladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstd
gtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgt
mwamcthgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfva
rnpeaeffldmllrsarac

SCOP Domain Coordinates for d1hp0a_:

Click to download the PDB-style file with coordinates for d1hp0a_.
(The format of our PDB-style files is described here.)

Timeline for d1hp0a_: