Lineage for d1hozb_ (1hoz B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 184714Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
  4. 184715Superfamily c.70.1: Nucleoside hydrolase [53590] (1 family) (S)
  5. 184716Family c.70.1.1: Nucleoside hydrolase [53591] (3 proteins)
  6. 184717Protein Inosine-adenosine-guanosine preferring nucleoside hydrolase [69587] (1 species)
  7. 184718Species Trypanosoma vivax [TaxId:5699] [69588] (4 PDB entries)
  8. 184720Domain d1hozb_: 1hoz B: [65899]

Details for d1hozb_

PDB Entry: 1hoz (more details), 1.6 Å

PDB Description: crystal structure of an inosine-adenosine-guanosine-preferring nucleoside hydrolase from trypanosoma vivax

SCOP Domain Sequences for d1hozb_:

Sequence, based on SEQRES records: (download)

>d1hozb_ c.70.1.1 (B:) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax}
saknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnn
mnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqql
ladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstd
gtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgt
mwamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdae
nypltfvarnpeaeffldmllrsarac

Sequence, based on observed residues (ATOM records): (download)

>d1hozb_ c.70.1.1 (B:) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax}
saknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnn
mnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqql
ladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstd
gtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgt
mwamyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfvarnpe
aeffldmllrsarac

SCOP Domain Coordinates for d1hozb_:

Click to download the PDB-style file with coordinates for d1hozb_.
(The format of our PDB-style files is described here.)

Timeline for d1hozb_: