Lineage for d1hoza_ (1hoz A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1180695Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 1180696Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 1180697Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins)
  6. 1180698Protein Inosine-adenosine-guanosine preferring nucleoside hydrolase [69587] (1 species)
  7. 1180699Species Trypanosoma vivax [TaxId:5699] [69588] (5 PDB entries)
  8. 1180702Domain d1hoza_: 1hoz A: [65898]
    complexed with ca, gol

Details for d1hoza_

PDB Entry: 1hoz (more details), 1.6 Å

PDB Description: crystal structure of an inosine-adenosine-guanosine-preferring nucleoside hydrolase from trypanosoma vivax
PDB Compounds: (A:) inosine-adenosine-guanosine-preferring nucleoside hydrolase

SCOPe Domain Sequences for d1hoza_:

Sequence, based on SEQRES records: (download)

>d1hoza_ c.70.1.1 (A:) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax [TaxId: 5699]}
gsaknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhn
nmnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqq
lladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpst
dgtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvg
tmwamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtda
enypltfvarnpeaeffldmllrsarac

Sequence, based on observed residues (ATOM records): (download)

>d1hoza_ c.70.1.1 (A:) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax [TaxId: 5699]}
gsaknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhn
nmnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqq
lladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpst
dgtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvg
tmwamyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfvarnp
eaeffldmllrsarac

SCOPe Domain Coordinates for d1hoza_:

Click to download the PDB-style file with coordinates for d1hoza_.
(The format of our PDB-style files is described here.)

Timeline for d1hoza_: