Lineage for d1hoza1 (1hoz A:2-327)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136733Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2136734Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2136735Family c.70.1.1: Nucleoside hydrolase [53591] (5 protein domains)
    automatically mapped to Pfam PF01156
  6. 2136736Protein Inosine-adenosine-guanosine preferring nucleoside hydrolase [69587] (1 species)
  7. 2136737Species Trypanosoma vivax [TaxId:5699] [69588] (5 PDB entries)
  8. 2136740Domain d1hoza1: 1hoz A:2-327 [65898]
    Other proteins in same PDB: d1hoza2, d1hozb2
    complexed with ca, gol

Details for d1hoza1

PDB Entry: 1hoz (more details), 1.6 Å

PDB Description: crystal structure of an inosine-adenosine-guanosine-preferring nucleoside hydrolase from trypanosoma vivax
PDB Compounds: (A:) inosine-adenosine-guanosine-preferring nucleoside hydrolase

SCOPe Domain Sequences for d1hoza1:

Sequence, based on SEQRES records: (download)

>d1hoza1 c.70.1.1 (A:2-327) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax [TaxId: 5699]}
aknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm
nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll
adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg
taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm
wamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaen
ypltfvarnpeaeffldmllrsarac

Sequence, based on observed residues (ATOM records): (download)

>d1hoza1 c.70.1.1 (A:2-327) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax [TaxId: 5699]}
aknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnnm
nlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqqll
adlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstdg
taewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgtm
wamyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdaenypltfvarnpea
effldmllrsarac

SCOPe Domain Coordinates for d1hoza1:

Click to download the PDB-style file with coordinates for d1hoza1.
(The format of our PDB-style files is described here.)

Timeline for d1hoza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hoza2