Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein MMP-2 [69778] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69779] (1 PDB entry) |
Domain d1hova_: 1hov A: [65897] complexed with ca, i52, zn |
PDB Entry: 1hov (more details)
SCOPe Domain Sequences for d1hova_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hova_ d.92.1.11 (A:) MMP-2 {Human (Homo sapiens) [TaxId: 9606]} mynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgead iminfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtntsanyslflvaah efghamglehsqdpgalmapiytytknfrlsqddikgiqelyg
Timeline for d1hova_: