Lineage for d1hova_ (1hov A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (10 proteins) 
Protein MMP-2 [69778] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69779] (1 PDB entry) 
Domain d1hova_: 1hov A: [65897]
Details for d1hova_
PDB Entry: 1hov (more details)
PDB Description: solution structure of a catalytic domain of mmp-2 complexed with sc- 74020
SCOP Domain Sequences for d1hova_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hova_ d.92.1.11 (A:) MMP-2 {Human (Homo sapiens)}
mynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgead
iminfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtntsanyslflvaah
efghamglehsqdpgalmapiytytknfrlsqddikgiqelyg
SCOP Domain Coordinates for d1hova_:
Click to download the PDB-style file with coordinates for d1hova_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hova_:
- d1hova_ is new in SCOP 1.59
- d1hova_ appears in SCOP 1.61
- d1hova_ appears in the current release, SCOPe 2.08
View in 3D