Lineage for d1hn4a_ (1hn4 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777954Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 777955Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 777960Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 777961Protein Phospholipase A2 [48637] (4 species)
  7. 778021Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (19 PDB entries)
  8. 778022Domain d1hn4a_: 1hn4 A: [65893]

Details for d1hn4a_

PDB Entry: 1hn4 (more details), 1.5 Å

PDB Description: prophospholipase a2 dimer complexed with mj33, sulfate, and calcium
PDB Compounds: (A:) prophospholipase a2

SCOP Domain Sequences for d1hn4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn4a_ a.133.1.2 (A:) Phospholipase A2 {Pig (Sus scrofa), pancreas [TaxId: 9823]}
gissralwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrda
knldsckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkeh
knldtkkyc

SCOP Domain Coordinates for d1hn4a_:

Click to download the PDB-style file with coordinates for d1hn4a_.
(The format of our PDB-style files is described here.)

Timeline for d1hn4a_: