Lineage for d1hn3a_ (1hn3 A:)

  1. Root: SCOPe 2.05
  2. 1973804Class j: Peptides [58231] (129 folds)
  3. 1975397Fold j.91: Tumor suppressor protein p19-ARF fragment [70042] (1 superfamily)
  4. 1975398Superfamily j.91.1: Tumor suppressor protein p19-ARF fragment [70043] (1 family) (S)
  5. 1975399Family j.91.1.1: Tumor suppressor protein p19-ARF fragment [70044] (1 protein)
  6. 1975400Protein Tumor suppressor protein p19-ARF fragment [70045] (1 species)
  7. 1975401Species Mouse (Mus musculus) [TaxId:10090] [70046] (1 PDB entry)
  8. 1975402Domain d1hn3a_: 1hn3 A: [65892]

Details for d1hn3a_

PDB Entry: 1hn3 (more details)

PDB Description: solution structure of the n-terminal 37 amino acids of the mouse arf tumor suppressor protein
PDB Compounds: (A:) p19 arf protein

SCOPe Domain Sequences for d1hn3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn3a_ j.91.1.1 (A:) Tumor suppressor protein p19-ARF fragment {Mouse (Mus musculus) [TaxId: 10090]}
gshmgrrflvtvriqragrplqervflvkfvrsrrprtas

SCOPe Domain Coordinates for d1hn3a_:

Click to download the PDB-style file with coordinates for d1hn3a_.
(The format of our PDB-style files is described here.)

Timeline for d1hn3a_: