SCOPe 2.05: Domain d1hn2b_: 1hn2 B:

Lineage for d1hn2b_ (1hn2 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Odorant-binding protein [50821] (2 species)
   C-termini swapping dimer

7. Species Cow (Bos taurus) [TaxId:9913] [50822] (8 PDB entries)

8. Domain d1hn2b_: 1hn2 B: [65891]
   complexed with 3ol, anc

Details for d1hn2b_

PDB Entry: 1hn2, 1.8 Å

PDB Description: crystal structure of bovine obp complexed with aminoanthracene

PDB Compounds: (B:) odorant-binding protein

SCOPe Domain Sequences for d1hn2b_:

Sequence; same for both SEQRES and ATOM records:

>d1hn2b_ b.60.1.1 (B:) Odorant-binding protein {Cow (Bos taurus) [TaxId: 9913]}
eeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrdg
kwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltelfvkl
nvededlekfwkltedkgidkknvvnflenenhph

Timeline for d1hn2b_:

• d1hn2b_ first appeared in SCOP 1.59
  
• d1hn2b_ appears in SCOPe 2.04
  
• d1hn2b_ appears in SCOPe 2.06
  
• d1hn2b_ appears in the current release, SCOPe 2.08