Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) |
Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) |
Family c.1.8.3: beta-glycanases [51487] (13 proteins) |
Protein beta-Galactosidase, domain 3 [51510] (1 species) |
Species Escherichia coli [TaxId:562] [51511] (23 PDB entries) |
Domain d1hn1d5: 1hn1 D:334-625 [65889] Other proteins in same PDB: d1hn1a1, d1hn1a2, d1hn1a3, d1hn1a4, d1hn1b1, d1hn1b2, d1hn1b3, d1hn1b4, d1hn1c1, d1hn1c2, d1hn1c3, d1hn1c4, d1hn1d1, d1hn1d2, d1hn1d3, d1hn1d4 |
PDB Entry: 1hn1 (more details), 3 Å
SCOP Domain Sequences for d1hn1d5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hn1d5 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1hn1d5:
View in 3D Domains from same chain: (mouse over for more information) d1hn1d1, d1hn1d2, d1hn1d3, d1hn1d4 |