Lineage for d1hn1d5 (1hn1 D:334-625)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116528Family c.1.8.3: beta-glycanases [51487] (13 proteins)
  6. 116533Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 116534Species Escherichia coli [TaxId:562] [51511] (23 PDB entries)
  8. 116658Domain d1hn1d5: 1hn1 D:334-625 [65889]
    Other proteins in same PDB: d1hn1a1, d1hn1a2, d1hn1a3, d1hn1a4, d1hn1b1, d1hn1b2, d1hn1b3, d1hn1b4, d1hn1c1, d1hn1c2, d1hn1c3, d1hn1c4, d1hn1d1, d1hn1d2, d1hn1d3, d1hn1d4

Details for d1hn1d5

PDB Entry: 1hn1 (more details), 3 Å

PDB Description: e. coli (lac z) beta-galactosidase (orthorhombic)

SCOP Domain Sequences for d1hn1d5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn1d5 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1hn1d5:

Click to download the PDB-style file with coordinates for d1hn1d5.
(The format of our PDB-style files is described here.)

Timeline for d1hn1d5: