Lineage for d1hn1d4 (1hn1 D:731-1023)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372004Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 372072Superfamily b.30.5: Galactose mutarotase-like [74650] (8 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 372073Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 372074Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 372075Species Escherichia coli [TaxId:562] [49997] (23 PDB entries)
  8. 372179Domain d1hn1d4: 1hn1 D:731-1023 [65888]
    Other proteins in same PDB: d1hn1a1, d1hn1a2, d1hn1a3, d1hn1a5, d1hn1b1, d1hn1b2, d1hn1b3, d1hn1b5, d1hn1c1, d1hn1c2, d1hn1c3, d1hn1c5, d1hn1d1, d1hn1d2, d1hn1d3, d1hn1d5
    complexed with mg, na

Details for d1hn1d4

PDB Entry: 1hn1 (more details), 3 Å

PDB Description: e. coli (lac z) beta-galactosidase (orthorhombic)

SCOP Domain Sequences for d1hn1d4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn1d4 b.30.5.1 (D:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1hn1d4:

Click to download the PDB-style file with coordinates for d1hn1d4.
(The format of our PDB-style files is described here.)

Timeline for d1hn1d4: