SCOP 1.61: Domain d1hn1d1: 1hn1 D:220-333

Lineage for d1hn1d1 (1hn1 D:220-333)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)

7. Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)

8. Domain d1hn1d1: 1hn1 D:220-333 [65885]
   Other proteins in same PDB: d1hn1a3, d1hn1a4, d1hn1a5, d1hn1b3, d1hn1b4, d1hn1b5, d1hn1c3, d1hn1c4, d1hn1c5, d1hn1d3, d1hn1d4, d1hn1d5

Details for d1hn1d1

PDB Entry: 1hn1, 3 Å

PDB Description: e. coli (lac z) beta-galactosidase (orthorhombic)

SCOP Domain Sequences for d1hn1d1:

Sequence; same for both SEQRES and ATOM records:

>d1hn1d1 b.1.4.1 (D:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

Timeline for d1hn1d1:

• d1hn1d1 first appeared in SCOP 1.59
  
• d1hn1d1 appears in SCOP 1.63
  
• d1hn1d1 appears in the current release, SCOPe 2.08