Lineage for d1hn1c5 (1hn1 C:334-625)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. Species Escherichia coli [TaxId:562] [51511] (46 PDB entries)
    Uniprot P00722
  8. Domain d1hn1c5: 1hn1 C:334-625 [65884]
    Other proteins in same PDB: d1hn1a1, d1hn1a2, d1hn1a3, d1hn1a4, d1hn1b1, d1hn1b2, d1hn1b3, d1hn1b4, d1hn1c1, d1hn1c2, d1hn1c3, d1hn1c4, d1hn1d1, d1hn1d2, d1hn1d3, d1hn1d4
    complexed with mg, na

Details for d1hn1c5

PDB Entry: 1hn1 (more details), 3 Å

PDB Description: e. coli (lac z) beta-galactosidase (orthorhombic)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1hn1c5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn1c5 c.1.8.3 (C:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1hn1c5 are not available.

Timeline for d1hn1c5:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hn1c1, d1hn1c2, d1hn1c3, d1hn1c4
View in 3D
Domains from other chains:
(mouse over for more information)
d1hn1a1, d1hn1a2, d1hn1a3, d1hn1a4, d1hn1a5, d1hn1b1, d1hn1b2, d1hn1b3, d1hn1b4, d1hn1b5, d1hn1d1, d1hn1d2, d1hn1d3, d1hn1d4, d1hn1d5