Class b: All beta proteins [48724] (180 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
Protein beta-Galactosidase, domain 5 [49996] (2 species) |
Species Escherichia coli [TaxId:562] [49997] (46 PDB entries) Uniprot P00722 |
Domain d1hn1c4: 1hn1 C:731-1023 [65883] Other proteins in same PDB: d1hn1a1, d1hn1a2, d1hn1a3, d1hn1a5, d1hn1b1, d1hn1b2, d1hn1b3, d1hn1b5, d1hn1c1, d1hn1c2, d1hn1c3, d1hn1c5, d1hn1d1, d1hn1d2, d1hn1d3, d1hn1d5 complexed with mg, na |
PDB Entry: 1hn1 (more details), 3 Å
SCOPe Domain Sequences for d1hn1c4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hn1c4 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d1hn1c4:
View in 3D Domains from same chain: (mouse over for more information) d1hn1c1, d1hn1c2, d1hn1c3, d1hn1c5 |