Lineage for d1hn1b2 (1hn1 B:626-730)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 290722Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 290723Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 290724Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 290725Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 290969Domain d1hn1b2: 1hn1 B:626-730 [65876]
    Other proteins in same PDB: d1hn1a3, d1hn1a4, d1hn1a5, d1hn1b3, d1hn1b4, d1hn1b5, d1hn1c3, d1hn1c4, d1hn1c5, d1hn1d3, d1hn1d4, d1hn1d5

Details for d1hn1b2

PDB Entry: 1hn1 (more details), 3 Å

PDB Description: e. coli (lac z) beta-galactosidase (orthorhombic)
PDB Compounds: (B:)

SCOP Domain Sequences for d1hn1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn1b2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOP Domain Coordinates for d1hn1b2:

Click to download the PDB-style file with coordinates for d1hn1b2.
(The format of our PDB-style files is described here.)

Timeline for d1hn1b2: