Lineage for d1hn1a3 (1hn1 A:13-219)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163940Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 163941Superfamily b.18.1: Galactose-binding domain-like [49785] (15 families) (S)
  5. 163983Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 163984Protein beta-Galactosidase [49804] (1 species)
  7. 163985Species Escherichia coli [TaxId:562] [49805] (23 PDB entries)
  8. 164106Domain d1hn1a3: 1hn1 A:13-219 [65872]
    Other proteins in same PDB: d1hn1a1, d1hn1a2, d1hn1a4, d1hn1a5, d1hn1b1, d1hn1b2, d1hn1b4, d1hn1b5, d1hn1c1, d1hn1c2, d1hn1c4, d1hn1c5, d1hn1d1, d1hn1d2, d1hn1d4, d1hn1d5

Details for d1hn1a3

PDB Entry: 1hn1 (more details), 3 Å

PDB Description: e. coli (lac z) beta-galactosidase (orthorhombic)

SCOP Domain Sequences for d1hn1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn1a3 b.18.1.5 (A:13-219) beta-Galactosidase {Escherichia coli}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1hn1a3:

Click to download the PDB-style file with coordinates for d1hn1a3.
(The format of our PDB-style files is described here.)

Timeline for d1hn1a3: