Lineage for d1hn1a2 (1hn1 A:626-730)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105419Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 105420Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 105421Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 105422Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 105664Domain d1hn1a2: 1hn1 A:626-730 [65871]
    Other proteins in same PDB: d1hn1a3, d1hn1a4, d1hn1a5, d1hn1b3, d1hn1b4, d1hn1b5, d1hn1c3, d1hn1c4, d1hn1c5, d1hn1d3, d1hn1d4, d1hn1d5

Details for d1hn1a2

PDB Entry: 1hn1 (more details), 3 Å

PDB Description: e. coli (lac z) beta-galactosidase (orthorhombic)

SCOP Domain Sequences for d1hn1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn1a2 b.1.4.1 (A:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOP Domain Coordinates for d1hn1a2:

Click to download the PDB-style file with coordinates for d1hn1a2.
(The format of our PDB-style files is described here.)

Timeline for d1hn1a2: