Lineage for d1hm9b1 (1hm9 B:252-459)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 234409Fold b.81: Single-stranded left-handed beta-helix [51160] (2 superfamilies)
    superhelix with each turn made by 3 strands with short links
  4. 234410Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (5 families) (S)
    duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 234466Family b.81.1.4: N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51171] (1 protein)
    this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
  6. 234467Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (2 species)
  7. 234475Species Streptococcus pneumoniae [TaxId:1313] [63852] (5 PDB entries)
  8. 234477Domain d1hm9b1: 1hm9 B:252-459 [65868]
    Other proteins in same PDB: d1hm9a2, d1hm9b2
    complexed with aco, ca, ud1

Details for d1hm9b1

PDB Entry: 1hm9 (more details), 1.75 Å

PDB Description: crystal structure of s.pneumoniae n-acetylglucosamine-1-phosphate uridyltransferase, glmu, bound to acetyl coenzyme a and udp-n- acetylglucosamine

SCOP Domain Sequences for d1hm9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hm9b1 b.81.1.4 (B:252-459) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae}
vsfvnpeatyididveiapevqieanvilkgqtkigaetvltngtyvvdstigagavitn
smieessvadgvtvgpyahirpnsslgaqvhignfvevkgssigentkaghltyigncev
gsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiapvelgdnslvgagstitkdvp
adaiaigrgrqinkdeyatrlphhpknq

SCOP Domain Coordinates for d1hm9b1:

Click to download the PDB-style file with coordinates for d1hm9b1.
(The format of our PDB-style files is described here.)

Timeline for d1hm9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hm9b2