Lineage for d1hm9a2 (1hm9 A:2-251)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 126172Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
  4. 126173Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (11 families) (S)
  5. 126215Family c.68.1.5: N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53461] (1 protein)
  6. 126216Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (2 species)
  7. 126224Species Streptococcus pneumoniae [TaxId:1313] [64134] (5 PDB entries)
  8. 126225Domain d1hm9a2: 1hm9 A:2-251 [65867]
    Other proteins in same PDB: d1hm9a1, d1hm9b1

Details for d1hm9a2

PDB Entry: 1hm9 (more details), 1.75 Å

PDB Description: crystal structure of s.pneumoniae n-acetylglucosamine-1-phosphate uridyltransferase, glmu, bound to acetyl coenzyme a and udp-n- acetylglucosamine

SCOP Domain Sequences for d1hm9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hm9a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae}
snfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelvee
vlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhinh
knvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintgtyvfdnerlf
ealknintnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmrr
rinhkhmvng

SCOP Domain Coordinates for d1hm9a2:

Click to download the PDB-style file with coordinates for d1hm9a2.
(The format of our PDB-style files is described here.)

Timeline for d1hm9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hm9a1