![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins) this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain |
![]() | Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (3 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [63852] (5 PDB entries) |
![]() | Domain d1hm9a1: 1hm9 A:252-459 [65866] Other proteins in same PDB: d1hm9a2, d1hm9b2 complexed with aco, ca, ud1 |
PDB Entry: 1hm9 (more details), 1.75 Å
SCOPe Domain Sequences for d1hm9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hm9a1 b.81.1.4 (A:252-459) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} vsfvnpeatyididveiapevqieanvilkgqtkigaetvltngtyvvdstigagavitn smieessvadgvtvgpyahirpnsslgaqvhignfvevkgssigentkaghltyigncev gsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiapvelgdnslvgagstitkdvp adaiaigrgrqinkdeyatrlphhpknq
Timeline for d1hm9a1: