Lineage for d1hm8b2 (1hm8 B:2-251)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898402Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 proteins)
  6. 2898403Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (3 species)
  7. 2898419Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [64134] (5 PDB entries)
  8. 2898426Domain d1hm8b2: 1hm8 B:2-251 [65865]
    Other proteins in same PDB: d1hm8a1, d1hm8b1
    complexed with aco, ca

Details for d1hm8b2

PDB Entry: 1hm8 (more details), 2.5 Å

PDB Description: crystal structure of s.pneumoniae n-acetylglucosamine-1-phosphate uridyltransferase, glmu, bound to acetyl coenzyme a
PDB Compounds: (B:) udp-n-acetylglucosamine-1-phosphate uridyltransferase

SCOPe Domain Sequences for d1hm8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hm8b2 c.68.1.5 (B:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
snfaiilaagkgtrmksdlpkvlhkvagismlehvfrsvgaiqpektvtvvghkaelvee
vlagqtefvtqseqlgtghavmmtepileglsghtlviagdtplitgeslknlidfhinh
knvatiltaetdnpfgygrivrndnaevlriveqkdatdfekqikeintgtyvfdnerlf
ealknintnnaqgeyyitdvigifretgekvgaytlkdfdeslgvndrvalataesvmrr
rinhkhmvng

SCOPe Domain Coordinates for d1hm8b2:

Click to download the PDB-style file with coordinates for d1hm8b2.
(The format of our PDB-style files is described here.)

Timeline for d1hm8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hm8b1