Lineage for d1hm0b1 (1hm0 B:252-447)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814014Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
    this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
  6. 2814029Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (3 species)
  7. 2814045Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [63852] (5 PDB entries)
  8. 2814050Domain d1hm0b1: 1hm0 B:252-447 [65860]
    Other proteins in same PDB: d1hm0a2, d1hm0b2
    complexed with ca

Details for d1hm0b1

PDB Entry: 1hm0 (more details), 2.3 Å

PDB Description: crystal structure of s.pneumoniae n-acetylglucosamine 1-phosphate uridyltransferase, glmu
PDB Compounds: (B:) n-acetylglucosamine 1-phosphate uridyltransferase

SCOPe Domain Sequences for d1hm0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hm0b1 b.81.1.4 (B:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
vsfvnpeatyididveiapevqieanvilkgqtkigaetvltngtyvvdstigagavitn
smieessvadgvtvgpyahirpnsslgaqvhignfvevkgssigentkaghltyigncev
gsnvnfgagtitvnydgknkyktvigdnvfvgsnstiiapvelgdnslvgagstitkdvp
adaiaigrgrqinkde

SCOPe Domain Coordinates for d1hm0b1:

Click to download the PDB-style file with coordinates for d1hm0b1.
(The format of our PDB-style files is described here.)

Timeline for d1hm0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hm0b2