Lineage for d1hlzb_ (1hlz B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035613Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 3035662Protein Orphan nuclear receptor reverb DNA-binding domain [57734] (1 species)
  7. 3035663Species Human (Homo sapiens) [TaxId:9606] [57735] (3 PDB entries)
  8. 3035671Domain d1hlzb_: 1hlz B: [65857]
    protein/DNA complex; complexed with zn

Details for d1hlzb_

PDB Entry: 1hlz (more details), 2.8 Å

PDB Description: crystal structure of the orphan nuclear receptor rev-erb(alpha) dna-binding domain bound to its cognate response element
PDB Compounds: (B:) orphan nuclear receptor nr1d1

SCOPe Domain Sequences for d1hlzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlzb_ g.39.1.2 (B:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
gmvllckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinrnrcq
qcrfkkclsvgmsrdavrfgr

SCOPe Domain Coordinates for d1hlzb_:

Click to download the PDB-style file with coordinates for d1hlzb_.
(The format of our PDB-style files is described here.)

Timeline for d1hlzb_: