Lineage for d1hlza_ (1hlz A:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271116Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 271117Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families) (S)
  5. 271131Family g.39.1.2: Nuclear receptor [57721] (8 proteins)
    duplication: two zinc-binding motifs
  6. 271151Protein Orphan nuclear receptor reverb [57734] (1 species)
  7. 271152Species Human (Homo sapiens) [TaxId:9606] [57735] (3 PDB entries)
  8. 271159Domain d1hlza_: 1hlz A: [65856]

Details for d1hlza_

PDB Entry: 1hlz (more details), 2.8 Å

PDB Description: crystal structure of the orphan nuclear receptor rev-erb(alpha) dna-binding domain bound to its cognate response element

SCOP Domain Sequences for d1hlza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlza_ g.39.1.2 (A:) Orphan nuclear receptor reverb {Human (Homo sapiens)}
vllckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinrnrcqqc
rfkkclsvgmsrdavrfgrip

SCOP Domain Coordinates for d1hlza_:

Click to download the PDB-style file with coordinates for d1hlza_.
(The format of our PDB-style files is described here.)

Timeline for d1hlza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hlzb_