Lineage for d1hlra3 (1hlr A:194-310)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132648Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
  4. 132649Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 132650Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (4 proteins)
  6. 132651Protein Aldehyde oxidoreductase, domain 3 [54667] (2 species)
  7. 132654Species Desulfovibrio gigas [TaxId:879] [54668] (1 PDB entry)
  8. 132655Domain d1hlra3: 1hlr A:194-310 [65852]
    Other proteins in same PDB: d1hlra1, d1hlra2, d1hlra4

Details for d1hlra3

PDB Entry: 1hlr (more details), 1.28 Å

PDB Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a
PDB Compounds: (A:)

SCOP Domain Sequences for d1hlra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlra3 d.41.1.1 (A:194-310) Aldehyde oxidoreductase, domain 3 {Desulfovibrio gigas}
dygadlglkmpagtlhlamvqakvshanikgidtsealtmpgvhsvithkdvkgknritg
litfptnkgdgwdrpilcdekvfqygdcialvcadseanaraaaekvkvdleelpay

SCOP Domain Coordinates for d1hlra3:

Click to download the PDB-style file with coordinates for d1hlra3.
(The format of our PDB-style files is described here.)

Timeline for d1hlra3: