Lineage for d1hlra2 (1hlr A:1-80)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 131113Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (8 proteins)
  6. 131114Protein Aldehyde oxidoreductase, N-terminal domain [54315] (2 species)
  7. 131117Species Desulfovibrio gigas [TaxId:879] [54316] (1 PDB entry)
  8. 131118Domain d1hlra2: 1hlr A:1-80 [65851]
    Other proteins in same PDB: d1hlra1, d1hlra3, d1hlra4

Details for d1hlra2

PDB Entry: 1hlr (more details), 1.28 Å

PDB Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a
PDB Compounds: (A:)

SCOP Domain Sequences for d1hlra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlra2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas}
miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac
vtkmkrvadgaqittiegvg

SCOP Domain Coordinates for d1hlra2:

Click to download the PDB-style file with coordinates for d1hlra2.
(The format of our PDB-style files is described here.)

Timeline for d1hlra2: