Lineage for d1hlra1 (1hlr A:81-193)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) 
Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (4 proteins) Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species) Species Desulfovibrio gigas [TaxId:879] [47744] (1 PDB entry) 
Domain d1hlra1: 1hlr A:81-193 [65850]
Other proteins in same PDB: d1hlra2, d1hlra3, d1hlra4
Details for d1hlra1
PDB Entry: 1hlr (more details), 1.28 Å
PDB Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a
SCOP Domain Sequences for d1hlra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlra1 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl
SCOP Domain Coordinates for d1hlra1:
Click to download the PDB-style file with coordinates for d1hlra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hlra1:
- d1hlra1 is new in SCOP 1.59
- d1hlra1 appears in SCOP 1.61
- d1hlra1 last appears in SCOP 1.67
View in 3D
